PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00679g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family WOX
Protein Properties Length: 212aa    MW: 24255.4 Da    PI: 9.4182
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00679g00320.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.5e-211069357
                              --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                              +R+++tkeq + Le+l+++  r+psae++++++++l    +++ ++V++WFqN++a++++
  Peaxi162Scf00679g00320.1 10 SRWNPTKEQMDLLENLYKQgIRTPSAEQIQQITMRLkafgHIEGKNVFYWFQNHKARQRQ 69
                              7*****************99**************************************97 PP

2Wus_type_Homeobox1147.4e-37971365
         Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                               +RW+Pt+eQ+ +Le+lyk+G+rtP++e+iq+it++L+++G+ie+kNVfyWFQN+kaR+rqkq
  Peaxi162Scf00679g00320.1  9 GSRWNPTKEQMDLLENLYKQGIRTPSAEQIQQITMRLKAFGHIEGKNVFYWFQNHKARQRQKQ 71
                              68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.948570IPR001356Homeobox domain
SMARTSM003893.5E-5774IPR001356Homeobox domain
SuperFamilySSF466894.06E-13778IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-81069IPR009057Homeodomain-like
PfamPF000462.0E-181069IPR001356Homeobox domain
CDDcd000864.62E-61171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MNDNMSPTGS RWNPTKEQMD LLENLYKQGI RTPSAEQIQQ ITMRLKAFGH IEGKNVFYWF  60
QNHKARQRQK QKQDHIAYNF NRFLHRTCVF PPPCPKVVCS PYYAPQSDLG FYQQCSVPRL  120
ILPGPGLFIR RRAACDAPAV YMISTNDANN HCQENSGMVE QLSPNAKQYN TNNNQQTLNL  180
FPLHPTGILQ ERTSTTSSSS SSSSHLSIKE NF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758504.11e-95PREDICTED: WUSCHEL-related homeobox 2
RefseqXP_016513970.11e-95PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K11e-48WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLK4C9W11e-78K4C9W1_SOLLC; Uncharacterized protein
STRINGSolyc06g076000.1.14e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-42WUSCHEL related homeobox 2